PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_36944.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YB
Protein Properties Length: 207aa    MW: 23591.7 Da    PI: 4.8405
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_36944.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB69.65.7e-221193385
         NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
                  ++d  lP + +++i+k++lP + ++++d+++++ ec +efi +++se++d c r+++kti+++ ++ al +lGf++yve++ +
  MLOC_36944.1 11 KEDVSLPKSTMTKIIKEMLPPDVRVARDTQDLLVECCVEFINLLSSESNDVCSRDDKKTIAPEHVIRALQDLGFKEYVEEVYA 93
                  67999**************************************************************************9754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.9E-378140IPR009072Histone-fold
SuperFamilySSF471137.71E-3412140IPR009072Histone-fold
PfamPF008081.8E-181579IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MDPMDIVGKS KEDVSLPKST MTKIIKEMLP PDVRVARDTQ DLLVECCVEF INLLSSESND  60
VCSRDDKKTI APEHVIRALQ DLGFKEYVEE VYAAYEHHKL DTLESPKASK FTRIEMTEEE  120
AVAEQQRMFA EARARMNNGA AKPKEPALEP QNQSQQLPQP QLQLHPQVQQ PPQPQPQLHP  180
QSQQPLQPQL QPYTQAQPQQ PLQPQLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-331213312133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0092340.0BT009234.1 Triticum aestivum clone wle1n.pk0106.g11:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235094.11e-112PREDICTED: nuclear transcription factor Y subunit beta-like
SwissprotP495923e-78NC2B_ARATH; Protein Dr1 homolog
TrEMBLM0VST31e-148M0VST3_HORVD; Uncharacterized protein
STRINGMLOC_36944.11e-148(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57203549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.43e-70nuclear factor Y, subunit B13